Lineage for d3tl2a1 (3tl2 A:1-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845909Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196222] (3 PDB entries)
  8. 2845910Domain d3tl2a1: 3tl2 A:1-147 [216865]
    Other proteins in same PDB: d3tl2a2
    automated match to d1i0za1
    complexed with edo, scn

Details for d3tl2a1

PDB Entry: 3tl2 (more details), 1.7 Å

PDB Description: crystal structure of bacillus anthracis str. ames malate dehydrogenase in closed conformation.
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3tl2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tl2a1 c.2.1.0 (A:1-147) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtikrkkvsvigagftgattafllaqkeladvvlvdipqlenptkgkaldmleaspvqgf
daniigtsdyadtadsdvvvitagiarkpgmsrddlvatnskimksitrdiakhspnaii
vvltnpvdamtysvfkeagfpkervig

SCOPe Domain Coordinates for d3tl2a1:

Click to download the PDB-style file with coordinates for d3tl2a1.
(The format of our PDB-style files is described here.)

Timeline for d3tl2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tl2a2