SCOPe 2.03: Domain d3tkyc1: 3tky C:16-122

Lineage for d3tkyc1 (3tky C:16-122)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Clarkia breweri [TaxId:36903] [226317] (2 PDB entries)

8. Domain d3tkyc1: 3tky C:16-122 [216861]
   Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2
   automated match to d1kyze1
   complexed with n7i, sah

Details for d3tkyc1

PDB Entry: 3tky, 2.47 Å

PDB Description: monolignol o-methyltransferase (momt)

PDB Compounds: (C:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3tkyc1:

Sequence; same for both SEQRES and ATOM records:

>d3tkyc1 a.4.5.0 (C:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Timeline for d3tkyc1:

• d3tkyc1 is new in SCOPe 2.03-stable
  
• d3tkyc1 appears in SCOPe 2.04
  
• d3tkyc1 appears in the current release, SCOPe 2.08