Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Vascular cell adhesion molecule-1 (VCAM-1) [49160] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49161] (3 PDB entries) |
Domain d1vcab2: 1vca B:1-90 [21686] Other proteins in same PDB: d1vcaa1, d1vcab1 D1 |
PDB Entry: 1vca (more details), 1.8 Å
SCOPe Domain Sequences for d1vcab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcab2 b.1.1.4 (B:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp vsfgnehsylctatcesrklekgiqveiys
Timeline for d1vcab2: