Lineage for d3tjzd_ (3tjz D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479742Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (6 PDB entries)
  8. 2479749Domain d3tjzd_: 3tjz D: [216850]
    automated match to d1vg9b_
    complexed with gnp, mg

Details for d3tjzd_

PDB Entry: 3tjz (more details), 2.9 Å

PDB Description: Crystal Structure of Arf1 Bound to the gamma/zeta-COP Core Complex
PDB Compounds: (D:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d3tjzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tjzd_ c.37.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mrilmvgldgagkttvlyklklgevittiptigfnvetvqyknisftvwdvggqdrirsl
wrhyyrntegvifvvdsndrsrigearevmqrmlnedelrnaawlvfankqdlpeamsaa
eiteklglhsirnrpwfiqatcatsgeglyeglewlsns

SCOPe Domain Coordinates for d3tjzd_:

Click to download the PDB-style file with coordinates for d3tjzd_.
(The format of our PDB-style files is described here.)

Timeline for d3tjzd_: