SCOPe 2.08: Domain d3tjzd_: 3tjz D:

Lineage for d3tjzd_ (3tjz D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (6 PDB entries)

8. Domain d3tjzd_: 3tjz D: [216850]
   automated match to d1vg9b_
   complexed with gnp, mg

Details for d3tjzd_

PDB Entry: 3tjz, 2.9 Å

PDB Description: Crystal Structure of Arf1 Bound to the gamma/zeta-COP Core Complex

PDB Compounds: (D:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d3tjzd_:

Sequence; same for both SEQRES and ATOM records:

>d3tjzd_ c.37.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mrilmvgldgagkttvlyklklgevittiptigfnvetvqyknisftvwdvggqdrirsl
wrhyyrntegvifvvdsndrsrigearevmqrmlnedelrnaawlvfankqdlpeamsaa
eiteklglhsirnrpwfiqatcatsgeglyeglewlsns

Timeline for d3tjzd_:

• d3tjzd_ first appeared in SCOPe 2.03
  
• d3tjzd_ appears in SCOPe 2.07