Lineage for d3tjta2 (3tjt A:121-230)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946374Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries)
  8. 2946375Domain d3tjta2: 3tjt A:121-230 [216848]
    Other proteins in same PDB: d3tjta1
    automated match to d1unfx2
    complexed with fe

Details for d3tjta2

PDB Entry: 3tjt (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the superoxide dismutase from Clostridium difficile
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d3tjta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tjta2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]}
ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds
pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl

SCOPe Domain Coordinates for d3tjta2:

Click to download the PDB-style file with coordinates for d3tjta2.
(The format of our PDB-style files is described here.)

Timeline for d3tjta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tjta1