Lineage for d3tjsa_ (3tjs A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005456Domain d3tjsa_: 3tjs A: [216846]
    automated match to d3ua1a_
    complexed with d0r, hem

Details for d3tjsa_

PDB Entry: 3tjs (more details), 2.25 Å

PDB Description: crystal structure of the complex between human cytochrome p450 3a4 and desthiazolylmethyloxycarbonyl ritonavir
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d3tjsa_:

Sequence, based on SEQRES records: (download)

>d3tjsa_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkhr
vdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdvq
qklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfi
pkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfa
lmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

Sequence, based on observed residues (ATOM records): (download)

>d3tjsa_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
kllfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrlehrvdflqlmidsq
nalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnkappty
dtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhrdpky
wtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnfsfkp
cketqiplklslggllqpekpvvlkvesr

SCOPe Domain Coordinates for d3tjsa_:

Click to download the PDB-style file with coordinates for d3tjsa_.
(The format of our PDB-style files is described here.)

Timeline for d3tjsa_: