SCOPe 2.06: Domain d3tjob1: 3tjo B:161-370

Lineage for d3tjob1 (3tjo B:161-370)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries)

8. Domain d3tjob1: 3tjo B:161-370 [216840]
   Other proteins in same PDB: d3tjoa2, d3tjob2, d3tjod2
   automated match to d1l1ja_
   complexed with bog, gol, so4; mutant

Details for d3tjob1

PDB Entry: 3tjo, 2.3 Å

PDB Description: htra1 catalytic domain, mutationally inactivated

PDB Compounds: (B:) Serine protease HTRA1

SCOPe Domain Sequences for d3tjob1:

Sequence, based on SEQRES records:

>d3tjob1 b.47.1.0 (B:161-370) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvv
aigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnaggplvnldgevi
gintlkvtagisfaipsdkikkflteshdr

Sequence, based on observed residues (ATOM records):

>d3tjob1 b.47.1.0 (B:161-370) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvv
aigspfslqntvttgivsttqdyiqtdaiinygnaggplvnldgevigintlkvtagisf
aipsdkikkflteshdr

Timeline for d3tjob1:

• d3tjob1 first appeared in SCOPe 2.03, called d3tjob_
  
• d3tjob1 was called d3tjob_ in SCOPe 2.05
  
• d3tjob1 appears in SCOPe 2.07
  
• d3tjob1 appears in the current release, SCOPe 2.08