Lineage for d3tjob1 (3tjo B:161-370)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390355Domain d3tjob1: 3tjo B:161-370 [216840]
    Other proteins in same PDB: d3tjoa2, d3tjob2, d3tjod2
    automated match to d1l1ja_
    complexed with bog, gol, so4; mutant

Details for d3tjob1

PDB Entry: 3tjo (more details), 2.3 Å

PDB Description: HtrA1 catalytic domain, mutationally inactivated
PDB Compounds: (B:) Serine protease HTRA1

SCOPe Domain Sequences for d3tjob1:

Sequence, based on SEQRES records: (download)

>d3tjob1 b.47.1.0 (B:161-370) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvv
aigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnaggplvnldgevi
gintlkvtagisfaipsdkikkflteshdr

Sequence, based on observed residues (ATOM records): (download)

>d3tjob1 b.47.1.0 (B:161-370) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvv
aigspfslqntvttgivsttqdyiqtdaiinygnaggplvnldgevigintlkvtagisf
aipsdkikkflteshdr

SCOPe Domain Coordinates for d3tjob1:

Click to download the PDB-style file with coordinates for d3tjob1.
(The format of our PDB-style files is described here.)

Timeline for d3tjob1: