SCOPe 2.07: Domain d1dr9a2: 1dr9 A:106-200

Lineage for d1dr9a2 (1dr9 A:106-200)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD80, second domain [49157] (1 species)
   a soluble form of b7-1

7. Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)

8. Domain d1dr9a2: 1dr9 A:106-200 [21684]
   Other proteins in same PDB: d1dr9a1
   complexed with nag

Details for d1dr9a2

PDB Entry: 1dr9, 3 Å

PDB Description: crystal structure of a soluble form of b7-1 (cd80)

PDB Compounds: (A:) t lymphocyte activation antigen

SCOPe Domain Sequences for d1dr9a2:

Sequence; same for both SEQRES and ATOM records:

>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnta

Timeline for d1dr9a2:

• d1dr9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1dr9a2 appears in SCOPe 2.06
  
• d1dr9a2 appears in the current release, SCOPe 2.08