SCOP 1.71: Domain d1dr9a2: 1dr9 A:106-200

Lineage for d1dr9a2 (1dr9 A:106-200)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein CD80, second domain [49157] (1 species)
   a soluble form of b7-1

7. Species Human (Homo sapiens) [TaxId:9606] [49158] (2 PDB entries)

8. Domain d1dr9a2: 1dr9 A:106-200 [21684]
   Other proteins in same PDB: d1dr9a1
   complexed with nag

Details for d1dr9a2

PDB Entry: 1dr9, 3 Å

PDB Description: crystal structure of a soluble form of b7-1 (cd80)

SCOP Domain Sequences for d1dr9a2:

Sequence; same for both SEQRES and ATOM records:

>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens)}
adfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelya
vsskldfnmttnhsfmclikyghlrvnqtfnwnta

Timeline for d1dr9a2:

• d1dr9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1dr9a2 appears in SCOP 1.69
  
• d1dr9a2 appears in SCOP 1.73
  
• d1dr9a2 appears in the current release, SCOPe 2.08