Lineage for d3tiua_ (3tiu A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057913Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2057935Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)
  8. 2057968Domain d3tiua_: 3tiu A: [216832]
    automated match to d2duca_
    complexed with dms, g82

Details for d3tiua_

PDB Entry: 3tiu (more details), 2.08 Å

PDB Description: crystal structure of sars coronavirus main protease complexed with an alpha,beta-unsaturated ethyl ester inhibitor sg82
PDB Compounds: (A:) SARS coronavirus main protease

SCOPe Domain Sequences for d3tiua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tiua_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d3tiua_:

Click to download the PDB-style file with coordinates for d3tiua_.
(The format of our PDB-style files is described here.)

Timeline for d3tiua_: