Lineage for d1ccza2 (1ccz A:94-171)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764328Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1764335Protein CD2-binding domain of CD58, second domain [49155] (1 species)
  7. 1764336Species Human (Homo sapiens) [TaxId:9606] [49156] (1 PDB entry)
  8. 1764337Domain d1ccza2: 1ccz A:94-171 [21683]
    Other proteins in same PDB: d1ccza1
    complexed with nag

Details for d1ccza2

PDB Entry: 1ccz (more details), 1.8 Å

PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution
PDB Compounds: (A:) protein (cd58)

SCOPe Domain Sequences for d1ccza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens) [TaxId: 9606]}
emvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkck
avnrvsqesemevvncpe

SCOPe Domain Coordinates for d1ccza2:

Click to download the PDB-style file with coordinates for d1ccza2.
(The format of our PDB-style files is described here.)

Timeline for d1ccza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ccza1