SCOPe 2.04: Domain d1ccza2: 1ccz A:94-171

Lineage for d1ccza2 (1ccz A:94-171)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD2-binding domain of CD58, second domain [49155] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49156] (1 PDB entry)

8. Domain d1ccza2: 1ccz A:94-171 [21683]
   Other proteins in same PDB: d1ccza1
   complexed with nag

Details for d1ccza2

PDB Entry: 1ccz, 1.8 Å

PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution

PDB Compounds: (A:) protein (cd58)

SCOPe Domain Sequences for d1ccza2:

Sequence; same for both SEQRES and ATOM records:

>d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens) [TaxId: 9606]}
emvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkck
avnrvsqesemevvncpe

Timeline for d1ccza2:

• d1ccza2 first appeared (with stable ids) in SCOP 1.55
  
• d1ccza2 appears in SCOPe 2.03
  
• d1ccza2 appears in SCOPe 2.05
  
• d1ccza2 appears in the current release, SCOPe 2.08