![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD2-binding domain of CD58, second domain [49155] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49156] (1 PDB entry) |
![]() | Domain d1ccza2: 1ccz A:94-171 [21683] Other proteins in same PDB: d1ccza1 complexed with nag |
PDB Entry: 1ccz (more details), 1.8 Å
SCOPe Domain Sequences for d1ccza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens) [TaxId: 9606]} emvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkck avnrvsqesemevvncpe
Timeline for d1ccza2: