Lineage for d1ccza2 (1ccz A:94-171)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54224Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 54231Protein CD2-binding domain of CD58, second domain [49155] (1 species)
  7. 54232Species Human (Homo sapiens) [TaxId:9606] [49156] (1 PDB entry)
  8. 54233Domain d1ccza2: 1ccz A:94-171 [21683]
    Other proteins in same PDB: d1ccza1

Details for d1ccza2

PDB Entry: 1ccz (more details), 1.8 Å

PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution

SCOP Domain Sequences for d1ccza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens)}
emvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkck
avnrvsqesemevvncpe

SCOP Domain Coordinates for d1ccza2:

Click to download the PDB-style file with coordinates for d1ccza2.
(The format of our PDB-style files is described here.)

Timeline for d1ccza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ccza1