Lineage for d1ccza2 (1ccz A:94-171)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.3: C2 set domains [49142] (7 proteins) Protein CD2-binding domain of CD58, second domain [49155] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49156] (1 PDB entry) 
Domain d1ccza2: 1ccz A:94-171 [21683]
Other proteins in same PDB: d1ccza1
Details for d1ccza2
PDB Entry: 1ccz (more details), 1.8 Å
PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution
SCOP Domain Sequences for d1ccza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens)}
emvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkck
avnrvsqesemevvncpe
SCOP Domain Coordinates for d1ccza2:
Click to download the PDB-style file with coordinates for d1ccza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccza2:
- d1ccza2 appears in SCOP 1.57
- d1ccza2 appears in the current release, SCOPe 2.08
View in 3D
