SCOPe 2.05: Domain d3tisa_: 3tis A:

Lineage for d3tisa_ (3tis A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193604] (2 PDB entries)

8. Domain d3tisa_: 3tis A: [216828]
   automated match to d3tioc_
   complexed with zn

Details for d3tisa_

PDB Entry: 3tis, 2.3 Å

PDB Description: Crystal structures of yrdA from Escherichia coli, a homologous protein of gamma-class carbonic anhydrases, show possible allosteric conformations

PDB Compounds: (A:) Protein YrdA

SCOPe Domain Sequences for d3tisa_:

Sequence, based on SEQRES records:

>d3tisa_ b.81.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgn

Sequence, based on observed residues (ATOM records):

>d3tisa_ b.81.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
dgsmlhvthksgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddvmiga
gslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgn

Timeline for d3tisa_:

• d3tisa_ first appeared in SCOPe 2.03
  
• d3tisa_ appears in SCOPe 2.04
  
• d3tisa_ appears in SCOPe 2.06
  
• d3tisa_ appears in the current release, SCOPe 2.08