SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3th8b_ (3th8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148252Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2148253Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2148254Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 protein domains)
    automatically mapped to Pfam PF01255
  6. 2148255Protein Undecaprenyl diphosphate synthase [64007] (3 species)
  7. 2148259Species Escherichia coli [TaxId:562] [64009] (16 PDB entries)
  8. 2148281Domain d3th8b_: 3th8 B: [216820]
    automated match to d1ueha_
    complexed with th9

Details for d3th8b_

PDB Entry: 3th8 (more details), 2.11 Å

PDB Description: Structure of E. coli undecaprenyl diphosphate synthase complexed with BPH-1063
PDB Compounds: (B:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3th8b_:

Sequence, based on SEQRES records: (download)

>d3th8b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsse
nwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtag
ntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvi
rtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records): (download)

>d3th8b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafmel
fvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggr
wdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwq
iayaelyftdvlwpdfdeqdfegalnafanr

SCOPe Domain Coordinates for d3th8b_:

Click to download the PDB-style file with coordinates for d3th8b_.
(The format of our PDB-style files is described here.)

Timeline for d3th8b_: