![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
![]() | Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
![]() | Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins) automatically mapped to Pfam PF01255 |
![]() | Protein Undecaprenyl diphosphate synthase [64007] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [64009] (17 PDB entries) |
![]() | Domain d3th8b_: 3th8 B: [216820] automated match to d1ueha_ complexed with th9 |
PDB Entry: 3th8 (more details), 2.11 Å
SCOPe Domain Sequences for d3th8b_:
Sequence, based on SEQRES records: (download)
>d3th8b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]} pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsse nwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtag ntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvi rtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr
>d3th8b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]} pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafmel fvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggr wdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwq iayaelyftdvlwpdfdeqdfegalnafanr
Timeline for d3th8b_: