Lineage for d1hngb2 (1hng B:100-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753467Protein CD2, second domain [49152] (2 species)
  7. 2753470Species Norway rat (Rattus norvegicus) [TaxId:10116] [49154] (1 PDB entry)
  8. 2753472Domain d1hngb2: 1hng B:100-176 [21682]
    Other proteins in same PDB: d1hnga1, d1hngb1

Details for d1hngb2

PDB Entry: 1hng (more details), 2.8 Å

PDB Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2
PDB Compounds: (B:) cd2

SCOPe Domain Sequences for d1hngb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hngb2 b.1.1.3 (B:100-176) CD2, second domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkcka
vnrvsqesemevvncpe

SCOPe Domain Coordinates for d1hngb2:

Click to download the PDB-style file with coordinates for d1hngb2.
(The format of our PDB-style files is described here.)

Timeline for d1hngb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hngb1