SCOPe 2.05: Domain d3th8a_: 3th8 A:

Lineage for d3th8a_ (3th8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (14 PDB entries)

8. Domain d3th8a_: 3th8 A: [216819]
   automated match to d1ueha_
   complexed with th9

Details for d3th8a_

PDB Entry: 3th8, 2.11 Å

PDB Description: structure of e. coli undecaprenyl diphosphate synthase complexed with bph-1063

PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3th8a_:

Sequence, based on SEQRES records:

>d3th8a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records):

>d3th8a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsvwald
sevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivqg
vrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayael
yftdvlwpdfdeqdfegalnafanr

Timeline for d3th8a_:

• d3th8a_ first appeared in SCOPe 2.03
  
• d3th8a_ appears in SCOPe 2.04
  
• d3th8a_ appears in SCOPe 2.06
  
• d3th8a_ appears in the current release, SCOPe 2.08