![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
![]() | Domain d3tgzb2: 3tgz B:92-241 [216816] Other proteins in same PDB: d3tgza1, d3tgzb1 automated match to d1k0ma1 mutant |
PDB Entry: 3tgz (more details), 2.3 Å
SCOPe Domain Sequences for d3tgzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tgzb2 a.45.1.1 (B:92-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvwryls nayareefastcpddeeielayeqvakalk
Timeline for d3tgzb2: