Lineage for d3tgzb1 (3tgz B:6-91)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879798Domain d3tgzb1: 3tgz B:6-91 [216815]
    Other proteins in same PDB: d3tgza2, d3tgzb2
    automated match to d1k0ma2
    mutant

Details for d3tgzb1

PDB Entry: 3tgz (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of W35F/H207W Mutant of Human CLIC1
PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3tgzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgzb1 c.47.1.0 (B:6-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqvelfvkagsdgakigncpfsqrlfmvlflkgvtfnvttvdtkrrtetvqklcpggqlp
fllygtevhtdtnkieefleavlcpp

SCOPe Domain Coordinates for d3tgzb1:

Click to download the PDB-style file with coordinates for d3tgzb1.
(The format of our PDB-style files is described here.)

Timeline for d3tgzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tgzb2