SCOPe 2.07: Domain d3tgza2: 3tgz A:92-241

Lineage for d3tgza2 (3tgz A:92-241)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d3tgza2: 3tgz A:92-241 [216814]
   Other proteins in same PDB: d3tgza1, d3tgzb1
   automated match to d1k0ma1
   mutant

Details for d3tgza2

PDB Entry: 3tgz, 2.3 Å

PDB Description: Crystal Structure Analysis of W35F/H207W Mutant of Human CLIC1

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3tgza2:

Sequence; same for both SEQRES and ATOM records:

>d3tgza2 a.45.1.1 (A:92-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvwryls
nayareefastcpddeeielayeqvakalk

Timeline for d3tgza2:

• d3tgza2 first appeared in SCOPe 2.03
  
• d3tgza2 appears in SCOPe 2.06
  
• d3tgza2 appears in the current release, SCOPe 2.08