Lineage for d3tg7a2 (3tg7 A:637-946)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2430859Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2430895Family b.121.2.2: Adenovirus hexon [49753] (2 proteins)
    each domain is heavily decorated with many insertions
  6. 2430896Protein Adenovirus hexon [63404] (2 species)
  7. 2430900Species Human adenovirus type 5 [TaxId:28285] [49756] (3 PDB entries)
  8. 2430902Domain d3tg7a2: 3tg7 A:637-946 [216810]
    automated match to d1p30a2

Details for d3tg7a2

PDB Entry: 3tg7 (more details), 1.57 Å

PDB Description: Crystal structure of Adenovirus serotype 5 hexon at 1.6A resolution
PDB Compounds: (A:) hexon protein

SCOPe Domain Sequences for d3tg7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tg7a2 b.121.2.2 (A:637-946) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]}
tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp
yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva
qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv
gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss
nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie
tvylrtpfsa

SCOPe Domain Coordinates for d3tg7a2:

Click to download the PDB-style file with coordinates for d3tg7a2.
(The format of our PDB-style files is described here.)

Timeline for d3tg7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tg7a1