![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD2, second domain [49152] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49154] (1 PDB entry) |
![]() | Domain d1hnga2: 1hng A:100-176 [21681] Other proteins in same PDB: d1hnga1, d1hngb1 |
PDB Entry: 1hng (more details), 2.8 Å
SCOPe Domain Sequences for d1hnga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnga2 b.1.1.3 (A:100-176) CD2, second domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} mvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkcka vnrvsqesemevvncpe
Timeline for d1hnga2: