SCOPe 2.08: Domain d1hnga2: 1hng A:100-176

Lineage for d1hnga2 (1hng A:100-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD2, second domain [49152] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49154] (1 PDB entry)

8. Domain d1hnga2: 1hng A:100-176 [21681]
   Other proteins in same PDB: d1hnga1, d1hngb1

Details for d1hnga2

PDB Entry: 1hng, 2.8 Å

PDB Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2

PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1hnga2:

Sequence; same for both SEQRES and ATOM records:

>d1hnga2 b.1.1.3 (A:100-176) CD2, second domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvskpmiywecsnatltcevlegtdvelklyqgkehlrslrqktmsyqwtnlrapfkcka
vnrvsqesemevvncpe

Timeline for d1hnga2:

• d1hnga2 first appeared (with stable ids) in SCOP 1.55
  
• d1hnga2 appears in SCOPe 2.07