Lineage for d3tg2a_ (3tg2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864428Species Vibrio cholerae [TaxId:666] [226451] (2 PDB entries)
  8. 2864429Domain d3tg2a_: 3tg2 A: [216808]
    automated match to d3r77a_
    complexed with isc, pge

Details for d3tg2a_

PDB Entry: 3tg2 (more details), 1.1 Å

PDB Description: Crystal structure of the ISC domain of VibB in complex with isochorismate
PDB Compounds: (A:) Vibriobactin-specific isochorismatase

SCOPe Domain Sequences for d3tg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tg2a_ c.33.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
aipkiasyplpvslptnkvdwridasravllihnmqeyfvhyfdsqaepipslikhiqql
kahakqagipvvytaqpanqdpaerallsdfwgpglseetaiiaplapesgdvqltkwry
safkksplldwlretgrdqliitgvyahigilstaldafmfdiqpfvigdgvadfslsdh
efslryisgrtgavkstqqacleia

SCOPe Domain Coordinates for d3tg2a_:

Click to download the PDB-style file with coordinates for d3tg2a_.
(The format of our PDB-style files is described here.)

Timeline for d3tg2a_: