SCOPe 2.03: Domain d3tfxb_: 3tfx B:

Lineage for d3tfxb_ (3tfx B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (20 species)
   not a true protein

7. Species Lactobacillus acidophilus [TaxId:1579] [226211] (1 PDB entry)

8. Domain d3tfxb_: 3tfx B: [216806]
   automated match to d3tr2b_

Details for d3tfxb_

PDB Entry: 3tfx, 2.19 Å

PDB Description: Crystal structure of Orotidine 5'-phosphate decarboxylase from Lactobacillus acidophilus

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3tfxb_:

Sequence, based on SEQRES records:

>d3tfxb_ c.1.2.0 (B:) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
drpvivaldldneeqlnkilsklgdphdvfvkvgmelfynagidvikkltqqgykifldl
kmhdipntvyngakalaklgitfttvhalggsqmiksakdgliagtpaghsvpkllavte
ltsisddvlrneqncrlpmaeqvlslakmakhsgadgvicsplevkklhenigddflyvt
pgirpagnakddqsrvatpkmakewgssaivvgrpitlasdpkaayeaikkefna

Sequence, based on observed residues (ATOM records):

>d3tfxb_ c.1.2.0 (B:) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
drpvivaldldneeqlnkilsklgdphdvfvkvgmelfynagidvikkltqqgykifldl
kmhdipntvyngakalaklgitfttvhalggsqmiksakdgliagtpaghsvpkllavte
ltsisddvlrneqncrlpmaeqvlslakmakhsgadgvicsplevkklhenigddflyvt
pgirpatpkmakewgssaivvgrpitlasdpkaayeaikkefna

Timeline for d3tfxb_:

• d3tfxb_ is new in SCOPe 2.03-stable
  
• d3tfxb_ appears in SCOPe 2.04
  
• d3tfxb_ appears in the current release, SCOPe 2.08, called d3tfxb1