Lineage for d3tfxb1 (3tfx B:2-235)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079900Species Lactobacillus acidophilus [TaxId:1579] [226211] (1 PDB entry)
  8. 2079902Domain d3tfxb1: 3tfx B:2-235 [216806]
    Other proteins in same PDB: d3tfxa2, d3tfxb2
    automated match to d3tr2b_

Details for d3tfxb1

PDB Entry: 3tfx (more details), 2.19 Å

PDB Description: Crystal structure of Orotidine 5'-phosphate decarboxylase from Lactobacillus acidophilus
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3tfxb1:

Sequence, based on SEQRES records: (download)

>d3tfxb1 c.1.2.0 (B:2-235) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
drpvivaldldneeqlnkilsklgdphdvfvkvgmelfynagidvikkltqqgykifldl
kmhdipntvyngakalaklgitfttvhalggsqmiksakdgliagtpaghsvpkllavte
ltsisddvlrneqncrlpmaeqvlslakmakhsgadgvicsplevkklhenigddflyvt
pgirpagnakddqsrvatpkmakewgssaivvgrpitlasdpkaayeaikkefn

Sequence, based on observed residues (ATOM records): (download)

>d3tfxb1 c.1.2.0 (B:2-235) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
drpvivaldldneeqlnkilsklgdphdvfvkvgmelfynagidvikkltqqgykifldl
kmhdipntvyngakalaklgitfttvhalggsqmiksakdgliagtpaghsvpkllavte
ltsisddvlrneqncrlpmaeqvlslakmakhsgadgvicsplevkklhenigddflyvt
pgirpatpkmakewgssaivvgrpitlasdpkaayeaikkefn

SCOPe Domain Coordinates for d3tfxb1:

Click to download the PDB-style file with coordinates for d3tfxb1.
(The format of our PDB-style files is described here.)

Timeline for d3tfxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tfxb2