SCOPe 2.05: Domain d1hnfa2: 1hnf A:105-182

Lineage for d1hnfa2 (1hnf A:105-182)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD2, second domain [49152] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49153] (1 PDB entry)

8. Domain d1hnfa2: 1hnf A:105-182 [21680]
   Other proteins in same PDB: d1hnfa1
   complexed with na, nag

Details for d1hnfa2

PDB Entry: 1hnf, 2.5 Å

PDB Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution

PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1hnfa2:

Sequence; same for both SEQRES and ATOM records:

>d1hnfa2 b.1.1.3 (A:105-182) CD2, second domain {Human (Homo sapiens) [TaxId: 9606]}
rvskpkiswtcinttltcevmngtdpelnlyqdgkhlklsqrvithkwttslsakfkcta
gnkvskessvepvscpek

Timeline for d1hnfa2:

• d1hnfa2 first appeared (with stable ids) in SCOP 1.55, called d1hnf_2
  
• d1hnfa2 appears in SCOPe 2.04
  
• d1hnfa2 appears in SCOPe 2.06
  
• d1hnfa2 appears in the current release, SCOPe 2.08