Lineage for d1hnf_2 (1hnf 105-182)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54224Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 54225Protein CD2, second domain [49152] (2 species)
  7. 54226Species Human (Homo sapiens) [TaxId:9606] [49153] (1 PDB entry)
  8. 54227Domain d1hnf_2: 1hnf 105-182 [21680]
    Other proteins in same PDB: d1hnf_1

Details for d1hnf_2

PDB Entry: 1hnf (more details), 2.5 Å

PDB Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution

SCOP Domain Sequences for d1hnf_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnf_2 b.1.1.3 (105-182) CD2, second domain {Human (Homo sapiens)}
rvskpkiswtcinttltcevmngtdpelnlyqdgkhlklsqrvithkwttslsakfkcta
gnkvskessvepvscpek

SCOP Domain Coordinates for d1hnf_2:

Click to download the PDB-style file with coordinates for d1hnf_2.
(The format of our PDB-style files is described here.)

Timeline for d1hnf_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnf_1