Lineage for d1hnfa2 (1hnf A:105-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753467Protein CD2, second domain [49152] (2 species)
  7. 2753468Species Human (Homo sapiens) [TaxId:9606] [49153] (1 PDB entry)
  8. 2753469Domain d1hnfa2: 1hnf A:105-182 [21680]
    Other proteins in same PDB: d1hnfa1
    complexed with na, nag

Details for d1hnfa2

PDB Entry: 1hnf (more details), 2.5 Å

PDB Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution
PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1hnfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnfa2 b.1.1.3 (A:105-182) CD2, second domain {Human (Homo sapiens) [TaxId: 9606]}
rvskpkiswtcinttltcevmngtdpelnlyqdgkhlklsqrvithkwttslsakfkcta
gnkvskessvepvscpek

SCOPe Domain Coordinates for d1hnfa2:

Click to download the PDB-style file with coordinates for d1hnfa2.
(The format of our PDB-style files is described here.)

Timeline for d1hnfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnfa1