![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD2, second domain [49152] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49153] (1 PDB entry) |
![]() | Domain d1hnfa2: 1hnf A:105-182 [21680] Other proteins in same PDB: d1hnfa1 complexed with na, nag |
PDB Entry: 1hnf (more details), 2.5 Å
SCOPe Domain Sequences for d1hnfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnfa2 b.1.1.3 (A:105-182) CD2, second domain {Human (Homo sapiens) [TaxId: 9606]} rvskpkiswtcinttltcevmngtdpelnlyqdgkhlklsqrvithkwttslsakfkcta gnkvskessvepvscpek
Timeline for d1hnfa2: