Lineage for d1cida2 (1cid A:106-177)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 786984Protein CD4 C2-set domains [49149] (2 species)
  7. 787022Species Rat (Rattus rattus) [TaxId:10117] [49151] (1 PDB entry)
  8. 787023Domain d1cida2: 1cid A:106-177 [21679]
    Other proteins in same PDB: d1cida1
    domain 4
    complexed with so4

Details for d1cida2

PDB Entry: 1cid (more details), 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOP Domain Sequences for d1cida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cida2 b.1.1.3 (A:106-177) CD4 C2-set domains {Rat (Rattus rattus) [TaxId: 10117]}
vmkvtqpdsntltcevmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllse
geevkmdskiqv

SCOP Domain Coordinates for d1cida2:

Click to download the PDB-style file with coordinates for d1cida2.
(The format of our PDB-style files is described here.)

Timeline for d1cida2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cida1