SCOPe 2.07: Domain d3tf2c_: 3tf2 C:

Lineage for d3tf2c_ (3tf2 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
   automatically mapped to Pfam PF01652

6. Protein Translation initiation factor eIF4e [55420] (3 species)
   messenger RNA 5' cap-binding protein

7. Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries)

8. Domain d3tf2c_: 3tf2 C: [216789]
   automated match to d1ipca_
   complexed with unx

Details for d3tf2c_

PDB Entry: 3tf2, 2.1 Å

PDB Description: crystal structure of the cap free human translation initiation factor eif4e

PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d3tf2c_:

Sequence, based on SEQRES records:

>d3tf2c_ d.86.1.1 (C:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
hyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
lfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
vvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttk
nrfvv

Sequence, based on observed residues (ATOM records):

>d3tf2c_ d.86.1.1 (C:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
hyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
lfkdgiepmwedeknkrggrwlitlnrsdldrfwletllcligesfddysddvcgavvnv
rakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatknrfvv

Timeline for d3tf2c_:

• d3tf2c_ first appeared in SCOPe 2.03
  
• d3tf2c_ appears in SCOPe 2.06
  
• d3tf2c_ appears in the current release, SCOPe 2.08