Lineage for d3tf2b_ (3tf2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962643Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2962644Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2962648Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries)
  8. 2962670Domain d3tf2b_: 3tf2 B: [216788]
    automated match to d1ipca_
    complexed with unx

Details for d3tf2b_

PDB Entry: 3tf2 (more details), 2.1 Å

PDB Description: crystal structure of the cap free human translation initiation factor eif4e
PDB Compounds: (B:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d3tf2b_:

Sequence, based on SEQRES records: (download)

>d3tf2b_ d.86.1.1 (B:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
kdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavv
nvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttknr
fvv

Sequence, based on observed residues (ATOM records): (download)

>d3tf2b_ d.86.1.1 (B:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
ikhplqnrwalwffknktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslfkdg
iepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavvnvr
akgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatttknrfvv

SCOPe Domain Coordinates for d3tf2b_:

Click to download the PDB-style file with coordinates for d3tf2b_.
(The format of our PDB-style files is described here.)

Timeline for d3tf2b_: