Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.0: automated matches [191506] (1 protein) not a true family |
Protein automated matches [190830] (9 species) not a true protein |
Species Acidianus sp. [TaxId:1071056] [193625] (2 PDB entries) |
Domain d3tenb_: 3ten B: [216780] automated match to d3teoo_ complexed with zn |
PDB Entry: 3ten (more details), 2.6 Å
SCOPe Domain Sequences for d3tenb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tenb_ c.53.2.0 (B:) automated matches {Acidianus sp. [TaxId: 1071056]} seyidselkrledyalrrvkgipnnrrlwvltcmdervhieqslgiqpddahiyrnaggi vtddairsaslttnffgtkeiivvthtdcgmlrftgeevakyfiskgikptevqldpllp afrisseedfikwfkfyedlgvkspdemalkgveilrnhplipkdvritgyvyevethrl rkpnqiiynetskfehgtivk
Timeline for d3tenb_: