Lineage for d3tehb5 (3teh B:475-681)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426487Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 1426488Species Thermus thermophilus [TaxId:274] [55704] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1426496Domain d3tehb5: 3teh B:475-681 [216777]
    Other proteins in same PDB: d3teha_, d3tehb1, d3tehb2, d3tehb3, d3tehb4, d3tehb6
    automated match to d1jjcb5
    complexed with dah

Details for d3tehb5

PDB Entry: 3teh (more details), 2.85 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with l-dopa
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3tehb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tehb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d3tehb5:

Click to download the PDB-style file with coordinates for d3tehb5.
(The format of our PDB-style files is described here.)

Timeline for d3tehb5: