SCOPe 2.03: Domain d3tehb3: 3teh B:191-399

Lineage for d3tehb3 (3teh B:191-399)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.153: PheT/TilS domain [56036] (1 superfamily)
   core: 3 layers; contains beta-sandwich of unusual topology

4. Superfamily b.153.1: PheT/TilS domain [56037] (2 families)
   contains putative tRNA-binding structural motif

5. Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
   Pfam PF03483; decorated with additional structures

6. Protein B3/B4 domain of PheRS, PheT [56039] (1 species)

7. Species Thermus thermophilus [TaxId:274] [56040] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d3tehb3: 3teh B:191-399 [216775]
   Other proteins in same PDB: d3teha_, d3tehb1, d3tehb2, d3tehb4, d3tehb5, d3tehb6
   automated match to d1jjcb6
   complexed with dah

Details for d3tehb3

PDB Entry: 3teh, 2.85 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with l-dopa

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3tehb3:

Sequence; same for both SEQRES and ATOM records:

>d3tehb3 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

Timeline for d3tehb3:

• d3tehb3 is new in SCOPe 2.03-stable
  
• d3tehb3 appears in SCOPe 2.04
  
• d3tehb3 appears in the current release, SCOPe 2.08