Class b: All beta proteins [48724] (180 folds) |
Fold b.153: PheT/TilS domain [56036] (1 superfamily) core: 3 layers; contains beta-sandwich of unusual topology |
Superfamily b.153.1: PheT/TilS domain [56037] (2 families) contains putative tRNA-binding structural motif |
Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) Pfam PF03483; decorated with additional structures |
Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d3tehb3: 3teh B:191-399 [216775] Other proteins in same PDB: d3teha_, d3tehb1, d3tehb2, d3tehb4, d3tehb5, d3tehb6 automated match to d1jjcb6 protein/RNA complex; complexed with dah |
PDB Entry: 3teh (more details), 2.85 Å
SCOPe Domain Sequences for d3tehb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tehb3 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]} lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv paqrralsllqalagarvaealleagspk
Timeline for d3tehb3: