SCOPe 2.03: Domain d3tehb2: 3teh B:39-151

Lineage for d3tehb2 (3teh B:39-151)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)
Family b.40.4.4: Myf domain [50277] (7 proteins)
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d3tehb2: 3teh B:39-151 [216774]
Other proteins in same PDB: d3teha_, d3tehb1, d3tehb3, d3tehb4, d3tehb5, d3tehb6
automated match to d1jjcb3
complexed with dah

Details for d3tehb2

PDB Entry: 3teh (more details), 2.85 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with l-dopa

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d3tehb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tehb2 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d3tehb2:

Click to download the PDB-style file with coordinates for d3tehb2.
(The format of our PDB-style files is described here.)

Timeline for d3tehb2: