Lineage for d3teha_ (3teh A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426474Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1426475Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1426483Domain d3teha_: 3teh A: [216772]
    Other proteins in same PDB: d3tehb1, d3tehb2, d3tehb3, d3tehb4, d3tehb5, d3tehb6
    automated match to d1eiya2
    complexed with dah

Details for d3teha_

PDB Entry: 3teh (more details), 2.85 Å

PDB Description: crystal structure of thermus thermophilus phenylalanyl-trna synthetase complexed with l-dopa
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d3teha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3teha_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d3teha_:

Click to download the PDB-style file with coordinates for d3teha_.
(The format of our PDB-style files is described here.)

Timeline for d3teha_: