![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d1wiqb3: 1wiq B:98-178 [21677] Other proteins in same PDB: d1wiqa1, d1wiqa2, d1wiqb1, d1wiqb2 domains 2 and 4 |
PDB Entry: 1wiq (more details), 5 Å
SCOPe Domain Sequences for d1wiqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiqb3 b.1.1.3 (B:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvla
Timeline for d1wiqb3:
![]() Domains from other chains: (mouse over for more information) d1wiqa1, d1wiqa2, d1wiqa3, d1wiqa4 |