Lineage for d3tdba1 (3tdb A:6-37)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077689Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2077690Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2077691Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2077725Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 2077726Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries)
  8. 2077751Domain d3tdba1: 3tdb A:6-37 [216765]
    Other proteins in same PDB: d3tdba2
    automated match to d1f8ab1
    complexed with 3tb, pe4

Details for d3tdba1

PDB Entry: 3tdb (more details), 2.27 Å

PDB Description: human pin1 bound to trans peptidomimetic inhibitor
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3tdba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tdba1 b.72.1.1 (A:6-37) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
klppgwekamsrssgrvyyfnhitnasqwerp

SCOPe Domain Coordinates for d3tdba1:

Click to download the PDB-style file with coordinates for d3tdba1.
(The format of our PDB-style files is described here.)

Timeline for d3tdba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tdba2