Lineage for d3td3g_ (3td3 G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421395Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 1421417Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 1421418Protein automated matches [195455] (5 species)
    not a true protein
  7. 1421419Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)
  8. 1421426Domain d3td3g_: 3td3 G: [216755]
    automated match to d2hqsc_
    complexed with gly

Details for d3td3g_

PDB Entry: 3td3 (more details), 1.59 Å

PDB Description: Crystal structure of OmpA-like domain from Acinetobacter baumannii in complex with glycine
PDB Compounds: (G:) Outer membrane protein omp38

SCOPe Domain Sequences for d3td3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3td3g_ d.79.7.0 (G:) automated matches {Acinetobacter baumannii [TaxId: 470]}
shmeltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprk
lnerlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitg
sr

SCOPe Domain Coordinates for d3td3g_:

Click to download the PDB-style file with coordinates for d3td3g_.
(The format of our PDB-style files is described here.)

Timeline for d3td3g_: