![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
![]() | Protein automated matches [195455] (13 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries) |
![]() | Domain d3td3e1: 3td3 E:221-339 [216753] Other proteins in same PDB: d3td3a2, d3td3b2, d3td3c2, d3td3d2, d3td3e2, d3td3f2, d3td3g2, d3td3h2 automated match to d2hqsc_ complexed with gly |
PDB Entry: 3td3 (more details), 1.59 Å
SCOPe Domain Sequences for d3td3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3td3e1 d.79.7.0 (E:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]} eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr
Timeline for d3td3e1: