Lineage for d3td3d1 (3td3 D:221-339)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960636Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)
  8. 2960640Domain d3td3d1: 3td3 D:221-339 [216752]
    Other proteins in same PDB: d3td3a2, d3td3b2, d3td3c2, d3td3d2, d3td3e2, d3td3f2, d3td3g2, d3td3h2
    automated match to d2hqsc_
    complexed with gly

Details for d3td3d1

PDB Entry: 3td3 (more details), 1.59 Å

PDB Description: Crystal structure of OmpA-like domain from Acinetobacter baumannii in complex with glycine
PDB Compounds: (D:) Outer membrane protein omp38

SCOPe Domain Sequences for d3td3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3td3d1 d.79.7.0 (D:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]}
eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne
rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr

SCOPe Domain Coordinates for d3td3d1:

Click to download the PDB-style file with coordinates for d3td3d1.
(The format of our PDB-style files is described here.)

Timeline for d3td3d1: