SCOP 1.57: Domain d1wiqa3: 1wiq A:98-178

Lineage for d1wiqa3 (1wiq A:98-178)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein CD4 [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)

8. Domain d1wiqa3: 1wiq A:98-178 [21675]
   Other proteins in same PDB: d1wiqa1, d1wiqa2, d1wiqb1, d1wiqb2

Details for d1wiqa3

PDB Entry: 1wiq, 5 Å

PDB Description: structure of t-cell surface glycoprotein cd4, trigonal crystal form

SCOP Domain Sequences for d1wiqa3:

Sequence; same for both SEQRES and ATOM records:

>d1wiqa3 b.1.1.3 (A:98-178) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d1wiqa3:

• d1wiqa3 first appeared (with stable ids) in SCOP 1.55
  
• d1wiqa3 appears in SCOP 1.59
  
• d1wiqa3 appears in the current release, SCOPe 2.08