Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
Species Human (Homo sapiens) [TaxId:9606] [54548] (33 PDB entries) |
Domain d3tcza2: 3tcz A:51-163 [216747] Other proteins in same PDB: d3tcza1 automated match to d2itka2 complexed with pe4, r2z |
PDB Entry: 3tcz (more details), 2.1 Å
SCOPe Domain Sequences for d3tcza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tcza2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d3tcza2: