Lineage for d3tcza2 (3tcz A:51-163)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408480Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 1408481Species Human (Homo sapiens) [TaxId:9606] [54548] (33 PDB entries)
  8. 1408504Domain d3tcza2: 3tcz A:51-163 [216747]
    Other proteins in same PDB: d3tcza1
    automated match to d2itka2
    complexed with pe4, r2z

Details for d3tcza2

PDB Entry: 3tcz (more details), 2.1 Å

PDB Description: human pin1 bound to cis peptidomimetic inhibitor
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3tcza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tcza2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d3tcza2:

Click to download the PDB-style file with coordinates for d3tcza2.
(The format of our PDB-style files is described here.)

Timeline for d3tcza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tcza1