SCOPe 2.08: Domain d3tcqa2: 3tcq A:204-308

Lineage for d3tcqa2 (3tcq A:204-308)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (2 families)

5. Family b.31.1.0: automated matches [227282] (1 protein)
   not a true family

6. Protein automated matches [227096] (1 species)
   not a true protein

7. Species Sudan ebolavirus [TaxId:128948] [226491] (1 PDB entry)

8. Domain d3tcqa2: 3tcq A:204-308 [216743]
   Other proteins in same PDB: d3tcqa1
   automated match to d1es6a2

Details for d3tcqa2

PDB Entry: 3tcq, 1.6 Å

PDB Description: crystal structure of matrix protein vp40 from ebola virus sudan

PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d3tcqa2:

Sequence, based on SEQRES records:

>d3tcqa2 b.31.1.0 (A:204-308) automated matches {Sudan ebolavirus [TaxId: 128948]}
rpglsfhpklrpvllpgktgkkghvsdltapdkiqtivnlmqdfkivpidpaksiigiev
pellvhkltgkkmsqkngqpiipvllpkyigldpispgdltmvit

Sequence, based on observed residues (ATOM records):

>d3tcqa2 b.31.1.0 (A:204-308) automated matches {Sudan ebolavirus [TaxId: 128948]}
rpglsfhpklrpvllpgtapdkiqtivnlmqdfkivpidpaksiigievpellvhkltgk
kmsqkngqpiipvllpkyigpgdltmvit

Timeline for d3tcqa2:

• d3tcqa2 first appeared in SCOPe 2.03
  
• d3tcqa2 appears in SCOPe 2.07