Lineage for d3tcqa1 (3tcq A:44-193)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782901Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 1782902Superfamily b.31.1: EV matrix protein [50012] (2 families) (S)
  5. 1782903Family b.31.1.1: EV matrix protein [50013] (2 proteins)
  6. 1782911Protein automated matches [227095] (3 species)
    not a true protein
  7. 1782920Species Sudan ebolavirus [TaxId:128948] [226490] (1 PDB entry)
  8. 1782921Domain d3tcqa1: 3tcq A:44-193 [216742]
    Other proteins in same PDB: d3tcqa2
    automated match to d1es6a1

Details for d3tcqa1

PDB Entry: 3tcq (more details), 1.6 Å

PDB Description: crystal structure of matrix protein vp40 from ebola virus sudan
PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d3tcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tcqa1 b.31.1.1 (A:44-193) automated matches {Sudan ebolavirus [TaxId: 128948]}
mdtpsnsmrpvaddnidhtshtpngvasafileatvnvisgpkvlmkqipiwlplgiadq
ktysfdsttaaimlasytithfgkannplvrvnrlgqgipdhplrllrmgnqaflqefvl
ppvqlpqyftfdltalklvtqplpaatwtd

SCOPe Domain Coordinates for d3tcqa1:

Click to download the PDB-style file with coordinates for d3tcqa1.
(The format of our PDB-style files is described here.)

Timeline for d3tcqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tcqa2