SCOPe 2.03: Domain d3tcqa1: 3tcq A:44-193

Lineage for d3tcqa1 (3tcq A:44-193)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (2 families)

5. Family b.31.1.1: EV matrix protein [50013] (2 proteins)

6. Protein automated matches [227095] (2 species)
   not a true protein

7. Species Sudan ebolavirus [TaxId:128948] [226490] (1 PDB entry)

8. Domain d3tcqa1: 3tcq A:44-193 [216742]
   Other proteins in same PDB: d3tcqa2
   automated match to d1es6a1

Details for d3tcqa1

PDB Entry: 3tcq, 1.6 Å

PDB Description: crystal structure of matrix protein vp40 from ebola virus sudan

PDB Compounds: (A:) matrix protein vp40

SCOPe Domain Sequences for d3tcqa1:

Sequence; same for both SEQRES and ATOM records:

>d3tcqa1 b.31.1.1 (A:44-193) automated matches {Sudan ebolavirus [TaxId: 128948]}
mdtpsnsmrpvaddnidhtshtpngvasafileatvnvisgpkvlmkqipiwlplgiadq
ktysfdsttaaimlasytithfgkannplvrvnrlgqgipdhplrllrmgnqaflqefvl
ppvqlpqyftfdltalklvtqplpaatwtd

Timeline for d3tcqa1:

• d3tcqa1 is new in SCOPe 2.03-stable
  
• d3tcqa1 appears in SCOPe 2.04
  
• d3tcqa1 appears in the current release, SCOPe 2.08